Lineage for d5ws6h_ (5ws6 h:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) 
automatically mapped to Pfam PF00737Family f.23.33.1: PsbH-like [161026] (2 proteins)
Pfam PF00737
Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) 
Domain d5ws6h_: 5ws6 h: [331506]
Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
automated match to d2axth1
complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl
Details for d5ws6h_
PDB Entry: 5ws6 (more details), 2.35 Å
PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (h:) Photosystem II reaction center protein HSCOPe Domain Sequences for d5ws6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws6h_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal
SCOPe Domain Coordinates for d5ws6h_:
Click to download the PDB-style file with coordinates for d5ws6h_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ws6h_:
View in 3D
