Lineage for d5ws6t_ (5ws6 T:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631879Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2631880Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 2631881Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2631896Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries)
  8. 2631909Domain d5ws6t_: 5ws6 T: [331595]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d3bz2t_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6t_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5ws6t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6t_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d5ws6t_:

Click to download the PDB-style file with coordinates for d5ws6t_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6t_: