SCOPe 2.07: Domain d5ws6u_: 5ws6 U:

Lineage for d5ws6u_ (5ws6 U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein automated matches [191005] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (5 PDB entries)

8. Domain d5ws6u_: 5ws6 U: [331585]
   Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6v_, d5ws6x_, d5ws6z_
   automated match to d2axtu1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6u_

PDB Entry: 5ws6, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5ws6u_:

Sequence; same for both SEQRES and ATOM records:

>d5ws6u_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5ws6u_:

• d5ws6u_ first appeared in SCOPe 2.06
  
• d5ws6u_ appears in the current release, SCOPe 2.08