SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jjma_ (5jjm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008489Species Human (Homo sapiens) [TaxId:9606] [63623] (62 PDB entries)
    Uniprot P10275 671-919
  8. 2287758Domain d5jjma_: 5jjm A: [331059]
    automated match to d1t65a_
    complexed with act, cl, dht, edo, gol, pge, so4, zn

Details for d5jjma_

PDB Entry: 5jjm (more details), 2.15 Å

PDB Description: crystal structure of homodimeric androgen receptor ligand-binding domain bound to dht and lxxll peptide
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d5jjma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjma_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
sgkvkpiyfhtq

SCOPe Domain Coordinates for d5jjma_:

Click to download the PDB-style file with coordinates for d5jjma_.
(The format of our PDB-style files is described here.)

Timeline for d5jjma_:

  • d5jjma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16