Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (13 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries) |
Domain d5icla1: 5icl A:1-247 [331053] Other proteins in same PDB: d5icla2, d5icla3, d5iclb2, d5iclb3 automated match to d1vqza2 complexed with laq |
PDB Entry: 5icl (more details), 1.8 Å
SCOPe Domain Sequences for d5icla1:
Sequence, based on SEQRES records: (download)
>d5icla1 d.104.1.0 (A:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]} mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlkvrkdkieskgiksvrs rvtnikpflsedkqemtteefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyr nwdwnyg
>d5icla1 d.104.1.0 (A:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]} mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlrvtnikpflsedkqemt teefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyrnwdwnyg
Timeline for d5icla1: