Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (5 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [330981] (5 PDB entries) |
Domain d5iclb2: 5icl B:248-334 [331249] Other proteins in same PDB: d5icla1, d5icla3, d5iclb1, d5iclb3 automated match to d1vqza1 complexed with laq |
PDB Entry: 5icl (more details), 1.8 Å
SCOPe Domain Sequences for d5iclb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iclb2 d.224.1.0 (B:248-334) automated matches {Enterococcus faecalis [TaxId: 226185]} kspafnlerrhrfpigsiemkmnvadgaiqeikifgdffglgeikdvediltgvkydkas leeaidqidvkkyfgniekedllgliy
Timeline for d5iclb2: