Class a: All alpha proteins [46456] (289 folds) |
Fold a.264: Duffy binding domain-like [140923] (1 superfamily) consist of two subdomains, each containing a three-helical bundle |
Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) automatically mapped to Pfam PF05424 |
Family a.264.1.1: Duffy binding domain [140925] (3 proteins) Pfam PF05424 |
Protein automated matches [191262] (2 species) not a true protein |
Species Plasmodium knowlesi [TaxId:5850] [330956] (1 PDB entry) |
Domain d5x6na_: 5x6n A: [330957] automated match to d2c6ja1 complexed with bog, so4 |
PDB Entry: 5x6n (more details), 3 Å
SCOPe Domain Sequences for d5x6na_:
Sequence, based on SEQRES records: (download)
>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]} kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlvnntrthshnditflklnlkrk lmydaavegdlllkknnyqynkefckdirwglgdfgdiimgtnmegigysqvvennlrsi fgtdekakqdrkqwwneskehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwire wgrdymselpkeqgklnekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlst kfssvkktqkigteniataydilkqelngfkeatfeneinkrdnlynhlcpcvv
>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]} kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlitflklnlkrklmydaavegdl llkknnyqynkefckdirwglgdfgdiimgtnmegvennlrsifgtdekakqdrkqwwne skehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwirewgrdymselpkeqgkln ekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlstkfssvkktqkiniatay dilkqelngfkeatfeneinkrdnlynhlcpcvv
Timeline for d5x6na_: