SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x6na_ (5x6n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016286Protein automated matches [191262] (2 species)
    not a true protein
  7. 2287655Species Plasmodium knowlesi [TaxId:5850] [330956] (1 PDB entry)
  8. 2287656Domain d5x6na_: 5x6n A: [330957]
    automated match to d2c6ja1
    complexed with bog, so4

Details for d5x6na_

PDB Entry: 5x6n (more details), 3 Å

PDB Description: structure of p. knowlesi dbl domain capable of binding human duffy antigen
PDB Compounds: (A:) Duffy binding protein

SCOPe Domain Sequences for d5x6na_:

Sequence, based on SEQRES records: (download)

>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlvnntrthshnditflklnlkrk
lmydaavegdlllkknnyqynkefckdirwglgdfgdiimgtnmegigysqvvennlrsi
fgtdekakqdrkqwwneskehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwire
wgrdymselpkeqgklnekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlst
kfssvkktqkigteniataydilkqelngfkeatfeneinkrdnlynhlcpcvv

Sequence, based on observed residues (ATOM records): (download)

>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlitflklnlkrklmydaavegdl
llkknnyqynkefckdirwglgdfgdiimgtnmegvennlrsifgtdekakqdrkqwwne
skehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwirewgrdymselpkeqgkln
ekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlstkfssvkktqkiniatay
dilkqelngfkeatfeneinkrdnlynhlcpcvv

SCOPe Domain Coordinates for d5x6na_:

Click to download the PDB-style file with coordinates for d5x6na_.
(The format of our PDB-style files is described here.)

Timeline for d5x6na_:

  • d5x6na_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09