Lineage for d5x6na_ (5x6n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016286Protein automated matches [191262] (2 species)
    not a true protein
  7. 2287655Species Plasmodium knowlesi [TaxId:5850] [330956] (1 PDB entry)
  8. 2287656Domain d5x6na_: 5x6n A: [330957]
    automated match to d2c6ja1
    complexed with bog, so4

Details for d5x6na_

PDB Entry: 5x6n (more details), 3 Å

PDB Description: structure of p. knowlesi dbl domain capable of binding human duffy antigen
PDB Compounds: (A:) Duffy binding protein

SCOPe Domain Sequences for d5x6na_:

Sequence, based on SEQRES records: (download)

>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlvnntrthshnditflklnlkrk
lmydaavegdlllkknnyqynkefckdirwglgdfgdiimgtnmegigysqvvennlrsi
fgtdekakqdrkqwwneskehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwire
wgrdymselpkeqgklnekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlst
kfssvkktqkigteniataydilkqelngfkeatfeneinkrdnlynhlcpcvv

Sequence, based on observed residues (ATOM records): (download)

>d5x6na_ a.264.1.1 (A:) automated matches {Plasmodium knowlesi [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlitflklnlkrklmydaavegdl
llkknnyqynkefckdirwglgdfgdiimgtnmegvennlrsifgtdekakqdrkqwwne
skehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwirewgrdymselpkeqgkln
ekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlstkfssvkktqkiniatay
dilkqelngfkeatfeneinkrdnlynhlcpcvv

SCOPe Domain Coordinates for d5x6na_:

Click to download the PDB-style file with coordinates for d5x6na_.
(The format of our PDB-style files is described here.)

Timeline for d5x6na_:

  • d5x6na_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09