SCOPe 2.07: Domain d5wtwb_: 5wtw B:

Lineage for d5wtwb_ (5wtw B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)

8. Domain d5wtwb_: 5wtw B: [330241]
   automated match to d4bmgc_
   complexed with cl; mutant

Details for d5wtwb_

PDB Entry: 5wtw, 2.62 Å

PDB Description: hepatitis b virus core protein y132a mutant in p 41 21 2 space group

PDB Compounds: (B:) Core protein

SCOPe Domain Sequences for d5wtwb_:

Sequence; same for both SEQRES and ATOM records:

>d5wtwb_ a.62.1.1 (B:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

Timeline for d5wtwb_:

• d5wtwb_ first appeared in SCOPe 2.06
  
• d5wtwb_ appears in the current release, SCOPe 2.08