Lineage for d5wtwb_ (5wtw B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325511Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2325512Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 2325513Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 protein domains)
  6. 2325520Protein automated matches [191131] (2 species)
    not a true protein
  7. 2325534Species Hepatitis B virus [TaxId:10407] [256206] (5 PDB entries)
  8. 2325552Domain d5wtwb_: 5wtw B: [330241]
    automated match to d4bmgc_
    complexed with cl; mutant

Details for d5wtwb_

PDB Entry: 5wtw (more details), 2.62 Å

PDB Description: hepatitis b virus core protein y132a mutant in p 41 21 2 space group
PDB Compounds: (B:) Core protein

SCOPe Domain Sequences for d5wtwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtwb_ a.62.1.1 (B:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

SCOPe Domain Coordinates for d5wtwb_:

Click to download the PDB-style file with coordinates for d5wtwb_.
(The format of our PDB-style files is described here.)

Timeline for d5wtwb_: