![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
![]() | Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) ![]() automatically mapped to Pfam PF00906 |
![]() | Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
![]() | Protein automated matches [191131] (3 species) not a true protein |
![]() | Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries) |
![]() | Domain d4bmgc_: 4bmg C: [251278] automated match to d3kxse_ |
PDB Entry: 4bmg (more details), 3 Å
SCOPe Domain Sequences for d4bmgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bmgc_ a.62.1.1 (C:) automated matches {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstl
Timeline for d4bmgc_: