Lineage for d4bmge_ (4bmg E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330003Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2330004Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2330005Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2330012Protein automated matches [191131] (3 species)
    not a true protein
  7. 2330039Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)
  8. 2330069Domain d4bmge_: 4bmg E: [251280]
    automated match to d3kxse_

Details for d4bmge_

PDB Entry: 4bmg (more details), 3 Å

PDB Description: crystal structure of hexameric hbc149 y132a
PDB Compounds: (E:) capsid protein

SCOPe Domain Sequences for d4bmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmge_ a.62.1.1 (E:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstl

SCOPe Domain Coordinates for d4bmge_:

Click to download the PDB-style file with coordinates for d4bmge_.
(The format of our PDB-style files is described here.)

Timeline for d4bmge_: