Class a: All alpha proteins [46456] (289 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein automated matches [191131] (3 species) not a true protein |
Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries) |
Domain d3kxse_: 3kxs E: [179800] automated match to d1qgtb_ mutant |
PDB Entry: 3kxs (more details), 2.25 Å
SCOPe Domain Sequences for d3kxse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kxse_ a.62.1.1 (E:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstl
Timeline for d3kxse_: