Lineage for d1qgtb_ (1qgt B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330003Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2330004Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2330005Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2330006Protein Hepatitis B viral capsid (hbcag) [47854] (1 species)
  7. 2330007Species Hepatitis B virus [TaxId:10407] [47855] (1 PDB entry)
  8. 2330009Domain d1qgtb_: 1qgt B: [18136]

Details for d1qgtb_

PDB Entry: 1qgt (more details), 3.3 Å

PDB Description: human hepatitis b viral capsid (hbcag)
PDB Compounds: (B:) protein (hbv capsid protein)

SCOPe Domain Sequences for d1qgtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgtb_ a.62.1.1 (B:) Hepatitis B viral capsid (hbcag) {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
cwgelmtlatwvgnnledpasrdlvvnyvntnmglkirqllwfhiscltfgretvleylv
sfgvwirtppayrppnapilstl

SCOPe Domain Coordinates for d1qgtb_:

Click to download the PDB-style file with coordinates for d1qgtb_.
(The format of our PDB-style files is described here.)

Timeline for d1qgtb_: