SCOP 1.63: Domain d1fhe_2: 1fhe 1-80

Lineage for d1fhe_2 (1fhe 1-80)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (6 species)

7. Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)

8. Domain d1fhe_2: 1fhe 1-80 [33020]
   Other proteins in same PDB: d1fhe_1
   complexed with gtt

Details for d1fhe_2

PDB Entry: 1fhe, 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica

SCOP Domain Sequences for d1fhe_2:

Sequence; same for both SEQRES and ATOM records:

>d1fhe_2 c.47.1.5 (1-80) Class alpha GST {Fasciola hepatica}
paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
kckltqsvaimryiadkhgm

Timeline for d1fhe_2:

• d1fhe_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fhe_2 appears in SCOP 1.61
  
• d1fhe_2 appears in SCOP 1.65
  
• d1fhe_2 appears in the current release, SCOPe 2.08, called d1fhea2