Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein automated matches [191218] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [329970] (6 PDB entries) |
Domain d5fu8b_: 5fu8 B: [330000] automated match to d1fxob_ complexed with cl, dh5, mes |
PDB Entry: 5fu8 (more details), 2.2 Å
SCOPe Domain Sequences for d5fu8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fu8b_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy
Timeline for d5fu8b_: