Lineage for d5fu8b_ (5fu8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133386Protein automated matches [191218] (4 species)
    not a true protein
  7. 2286669Species Pseudomonas aeruginosa [TaxId:287] [329970] (6 PDB entries)
  8. 2286699Domain d5fu8b_: 5fu8 B: [330000]
    automated match to d1fxob_
    complexed with cl, dh5, mes

Details for d5fu8b_

PDB Entry: 5fu8 (more details), 2.2 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5fu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fu8b_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d5fu8b_:

Click to download the PDB-style file with coordinates for d5fu8b_.
(The format of our PDB-style files is described here.)

Timeline for d5fu8b_:

  • d5fu8b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-22