Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5u3pl2: 5u3p L:108-212 [329929] Other proteins in same PDB: d5u3pl1 automated match to d1c5cl2 |
PDB Entry: 5u3p (more details), 1.5 Å
SCOPe Domain Sequences for d5u3pl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u3pl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d5u3pl2: