Lineage for d5tr2b4 (5tr2 B:422-562)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581959Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2581998Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2581999Protein automated matches [254722] (4 species)
    not a true protein
  7. 2582003Species Human (Homo sapiens) [TaxId:9606] [316258] (15 PDB entries)
  8. 2582023Domain d5tr2b4: 5tr2 B:422-562 [329561]
    Other proteins in same PDB: d5tr2a1, d5tr2a2, d5tr2a3, d5tr2a5, d5tr2b1, d5tr2b2, d5tr2b3
    automated match to d5f9ca4
    complexed with ca, gol, so4

Details for d5tr2b4

PDB Entry: 5tr2 (more details), 2.5 Å

PDB Description: crystal structure of the d263g missense variant of human pgm1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5tr2b4:

Sequence, based on SEQRES records: (download)

>d5tr2b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d5tr2b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsagatirlyidsyekdvakinqdpqvmlaplisialk
vsqlqertgrtaptvit

SCOPe Domain Coordinates for d5tr2b4:

Click to download the PDB-style file with coordinates for d5tr2b4.
(The format of our PDB-style files is described here.)

Timeline for d5tr2b4: