Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d5f61b1: 5f61 B:44-168 [329417] Other proteins in same PDB: d5f61a2, d5f61b2 automated match to d4hbwa_ complexed with 5w0, edo |
PDB Entry: 5f61 (more details), 1.45 Å
SCOPe Domain Sequences for d5f61b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f61b1 a.29.2.0 (B:44-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lptee
Timeline for d5f61b1: