Lineage for d5ta4a_ (5ta4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064274Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2064289Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (113 PDB entries)
    Uniprot P05092
  8. 2285729Domain d5ta4a_: 5ta4 A: [329030]
    automated match to d2cyha_
    complexed with 838, so4

Details for d5ta4a_

PDB Entry: 5ta4 (more details), 1.5 Å

PDB Description: discovery of a potent cyclophilin inhibitor (compound 8) based on structural simplification of sanglifehrin a
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d5ta4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ta4a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d5ta4a_:

Click to download the PDB-style file with coordinates for d5ta4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ta4a_:

  • d5ta4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26