Lineage for d1hna_2 (1hna 1-84)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 70977Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 70978Domain d1hna_2: 1hna 1-84 [32898]
    Other proteins in same PDB: d1hna_1

Details for d1hna_2

PDB Entry: 1hna (more details), 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hna_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hna_2 c.47.1.5 (1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hna_2:

Click to download the PDB-style file with coordinates for d1hna_2.
(The format of our PDB-style files is described here.)

Timeline for d1hna_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hna_1