Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) |
Domain d1hna_2: 1hna 1-84 [32898] Other proteins in same PDB: d1hna_1 |
PDB Entry: 1hna (more details), 1.85 Å
SCOP Domain Sequences for d1hna_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hna_2 c.47.1.5 (1-84) Glutathione S-transferase {Human (Homo sapiens), class mu} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d1hna_2: