SCOPe 2.08: Domain d1hnaa2: 1hna A:1-84

Lineage for d1hnaa2 (1hna A:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
   Uniprot P09488 ! Uniprot P28161

8. Domain d1hnaa2: 1hna A:1-84 [32898]
   Other proteins in same PDB: d1hnaa1
   complexed with gdn

Details for d1hnaa2

PDB Entry: 1hna, 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1hnaa2:

Sequence; same for both SEQRES and ATOM records:

>d1hnaa2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d1hnaa2:

• d1hnaa2 first appeared (with stable ids) in SCOP 1.55, called d1hna_2
  
• d1hnaa2 appears in SCOPe 2.07