Lineage for d1hna_1 (1hna 85-217)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins) Protein Glutathione S-transferase [47618] (24 species) 
Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries) 
Domain d1hna_1: 1hna 85-217 [17604]
Other proteins in same PDB: d1hna_2
Details for d1hna_1
PDB Entry: 1hna (more details), 1.85 Å
PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
SCOP Domain Sequences for d1hna_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hna_1 a.45.1.1 (85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk
SCOP Domain Coordinates for d1hna_1:
Click to download the PDB-style file with coordinates for d1hna_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hna_1:
- d1hna_1 first appeared (with stable ids) in SCOP 1.55
- d1hna_1 appears in SCOP 1.59
- d1hna_1 appears in the current release, SCOPe 2.08, called d1hnaa1
View in 3D
