Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries) |
Domain d5hjfb_: 5hjf B: [328946] Other proteins in same PDB: d5hjfd2 automated match to d4cyba_ |
PDB Entry: 5hjf (more details), 1.59 Å
SCOPe Domain Sequences for d5hjfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjfb_ a.25.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 272131]} tqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslh effnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendla aeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
Timeline for d5hjfb_:
View in 3D Domains from other chains: (mouse over for more information) d5hjfa_, d5hjfc_, d5hjfd1, d5hjfd2 |