SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hjfb_ (5hjf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (37 species)
    not a true protein
  7. 2285537Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2285645Domain d5hjfb_: 5hjf B: [328946]
    Other proteins in same PDB: d5hjfd2
    automated match to d4cyba_

Details for d5hjfb_

PDB Entry: 5hjf (more details), 1.59 Å

PDB Description: the apo form of dps4 from nostoc punctiforme
PDB Compounds: (B:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjfb_ a.25.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslh
effnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendla
aeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

SCOPe Domain Coordinates for d5hjfb_:

Click to download the PDB-style file with coordinates for d5hjfb_.
(The format of our PDB-style files is described here.)

Timeline for d5hjfb_:

  • d5hjfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26