Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries) |
Domain d5hjhb_: 5hjh B: [328925] automated match to d4cybj_ complexed with epe, fe |
PDB Entry: 5hjh (more details), 1.88 Å
SCOPe Domain Sequences for d5hjhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjhb_ a.25.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 272131]} tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
Timeline for d5hjhb_: