SCOPe 2.06: Domain d5hjhc_: 5hjh C:

Lineage for d5hjhc_ (5hjh C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)

8. Domain d5hjhc_: 5hjh C: [328845]
   automated match to d4cybj_
   complexed with epe, fe

Details for d5hjhc_

PDB Entry: 5hjh, 1.88 Å

PDB Description: dps4 from nostoc punctiforme in complex with fe ions

PDB Compounds: (C:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjhc_:

Sequence; same for both SEQRES and ATOM records:

>d5hjhc_ a.25.1.0 (C:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

Timeline for d5hjhc_:

• d5hjhc_ is new in SCOPe 2.06-stable
  
• d5hjhc_ appears in SCOPe 2.07
  
• d5hjhc_ appears in the current release, SCOPe 2.08