Lineage for d5huha_ (5huh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861391Protein automated matches [190257] (5 species)
    not a true protein
  7. 2861406Species Streptococcus pyogenes [TaxId:471876] [328854] (2 PDB entries)
  8. 2861409Domain d5huha_: 5huh A: [328890]
    automated match to d3hmqa_
    complexed with mg, so4

Details for d5huha_

PDB Entry: 5huh (more details), 2.5 Å

PDB Description: crystal structure of nade from streptococcus pyogenes
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5huha_:

Sequence, based on SEQRES records: (download)

>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve
alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad
ilplfrlnkrqgkallkvlgadaalyekvptadledqkpgladevalgvtyqdiddyleg
kliskvaqatiekwwhkgqhkrhlpitifadfwk

Sequence, based on observed residues (ATOM records): (download)

>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve
alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad
ilplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiek
wwhkgqhkrhlpitifadfwk

SCOPe Domain Coordinates for d5huha_:

Click to download the PDB-style file with coordinates for d5huha_.
(The format of our PDB-style files is described here.)

Timeline for d5huha_: