SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5huha_ (5huh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106294Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 protein domains)
  6. 2106421Protein automated matches [190257] (4 species)
    not a true protein
  7. 2285553Species Streptococcus pyogenes [TaxId:471876] [328854] (2 PDB entries)
  8. 2285589Domain d5huha_: 5huh A: [328890]
    automated match to d3hmqa_
    complexed with mg, so4

Details for d5huha_

PDB Entry: 5huh (more details), 2.5 Å

PDB Description: crystal structure of nade from streptococcus pyogenes
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5huha_:

Sequence, based on SEQRES records: (download)

>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve
alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad
ilplfrlnkrqgkallkvlgadaalyekvptadledqkpgladevalgvtyqdiddyleg
kliskvaqatiekwwhkgqhkrhlpitifadfwk

Sequence, based on observed residues (ATOM records): (download)

>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve
alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad
ilplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiek
wwhkgqhkrhlpitifadfwk

SCOPe Domain Coordinates for d5huha_:

Click to download the PDB-style file with coordinates for d5huha_.
(The format of our PDB-style files is described here.)

Timeline for d5huha_:

  • d5huha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25