Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein automated matches [190257] (5 species) not a true protein |
Species Streptococcus pyogenes [TaxId:471876] [328854] (2 PDB entries) |
Domain d5huha_: 5huh A: [328890] automated match to d3hmqa_ complexed with mg, so4 |
PDB Entry: 5huh (more details), 2.5 Å
SCOPe Domain Sequences for d5huha_:
Sequence, based on SEQRES records: (download)
>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]} mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad ilplfrlnkrqgkallkvlgadaalyekvptadledqkpgladevalgvtyqdiddyleg kliskvaqatiekwwhkgqhkrhlpitifadfwk
>d5huha_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]} mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad ilplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiek wwhkgqhkrhlpitifadfwk
Timeline for d5huha_: