Lineage for d5uaia1 (5uai A:4-207)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500328Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2500329Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2500447Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2500448Protein automated matches [191110] (11 species)
    not a true protein
  7. 2500476Species Pseudomonas aeruginosa [TaxId:208964] [328727] (1 PDB entry)
  8. 2500477Domain d5uaia1: 5uai A:4-207 [328779]
    Other proteins in same PDB: d5uaia2, d5uaib2, d5uaic2, d5uaid2
    automated match to d3r8xa1
    complexed with edo

Details for d5uaia1

PDB Entry: 5uai (more details), 2.75 Å

PDB Description: crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d5uaia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaia1 c.65.1.0 (A:4-207) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
alrivfagtpefaaehlkalldtphrivavytqpdrpagrgqklmpsavkslalehglpv
mqpqslrnaeaqaelaalradlmvvvayglilpqavldiprlgcinshasllprwrgaap
iqraveagdaesgvtvmqmeagldtgpmllkvstpisaadtggslhdrlaalgpkaviea
iaglaagtlhgeiqddalatyahk

SCOPe Domain Coordinates for d5uaia1:

Click to download the PDB-style file with coordinates for d5uaia1.
(The format of our PDB-style files is described here.)

Timeline for d5uaia1: