![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
![]() | Protein automated matches [191110] (11 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [328727] (1 PDB entry) |
![]() | Domain d5uaia1: 5uai A:4-207 [328779] Other proteins in same PDB: d5uaia2, d5uaib2, d5uaic2, d5uaid2 automated match to d3r8xa1 complexed with edo |
PDB Entry: 5uai (more details), 2.75 Å
SCOPe Domain Sequences for d5uaia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uaia1 c.65.1.0 (A:4-207) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} alrivfagtpefaaehlkalldtphrivavytqpdrpagrgqklmpsavkslalehglpv mqpqslrnaeaqaelaalradlmvvvayglilpqavldiprlgcinshasllprwrgaap iqraveagdaesgvtvmqmeagldtgpmllkvstpisaadtggslhdrlaalgpkaviea iaglaagtlhgeiqddalatyahk
Timeline for d5uaia1: