Class b: All beta proteins [48724] (178 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (7 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [328729] (1 PDB entry) |
Domain d5uaib2: 5uai B:208-313 [328730] Other proteins in same PDB: d5uaia1, d5uaib1, d5uaic1, d5uaid1 automated match to d3r8xa2 complexed with edo |
PDB Entry: 5uai (more details), 2.75 Å
SCOPe Domain Sequences for d5uaib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uaib2 b.46.1.0 (B:208-313) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} lnkdearldwsrpavelerqvraftpwpvchtsladaplkvlgaslgqgsgapgtileas rdgllvacgegalrltrlqlpggkplafadlynsrreqfaagqvlg
Timeline for d5uaib2: