SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ucrb1 (5ucr B:21-275)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2276810Species Neisseria gonorrhoeae [TaxId:521006] [320111] (2 PDB entries)
  8. 2285047Domain d5ucrb1: 5ucr B:21-275 [328348]
    Other proteins in same PDB: d5ucra2, d5ucrb2
    automated match to d1ihoa_
    complexed with ala, anp, mg

Details for d5ucrb1

PDB Entry: 5ucr (more details), 2.25 Å

PDB Description: crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp and alanine
PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d5ucrb1:

Sequence, based on SEQRES records: (download)

>d5ucrb1 c.26.1.0 (B:21-275) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
afvptmgnlheghlalvrearkradnvvvsifvnrlqfgqgedfdkyprtlqqdadklaa
egvavvfapdekelypnveqrynvepphlqnelcgkfrpghfrgvatvvsklfnivlpdv
acfgkkdyqqlavikgltedlnfdieivpvdtgraadglalssrnrylsvgeraeaprly
relqavaeslkqggldyaglerqaadhltaagwlvdyveirradtlemaragdkklvvla
aarlgttrlidnvev

Sequence, based on observed residues (ATOM records): (download)

>d5ucrb1 c.26.1.0 (B:21-275) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
afvptmgnlheghlalvrearkradnvvvsifvnrlqprtlqqdadklaaegvavvfapd
ekelypnveqrynvepphlqnelcgkfrpghfrgvatvvsklfnivlpdvacfgkkdyqq
lavikgltedlnfdieivpvdtgraadglalssrnrylsvgeraeaprlyrelqavaesl
kqggldyaglerqaadhltaagwlvdyveirradtlemaragdkklvvlaaarlgttrli
dnvev

SCOPe Domain Coordinates for d5ucrb1:

Click to download the PDB-style file with coordinates for d5ucrb1.
(The format of our PDB-style files is described here.)

Timeline for d5ucrb1:

  • d5ucrb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5ucrb2