Lineage for d5ucra1 (5ucr A:21-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (47 species)
    not a true protein
  7. 2276810Species Neisseria gonorrhoeae [TaxId:521006] [320111] (2 PDB entries)
  8. 2285054Domain d5ucra1: 5ucr A:21-278 [328355]
    Other proteins in same PDB: d5ucra2, d5ucrb2
    automated match to d1ihoa_
    complexed with ala, anp, mg

Details for d5ucra1

PDB Entry: 5ucr (more details), 2.25 Å

PDB Description: crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp and alanine
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d5ucra1:

Sequence, based on SEQRES records: (download)

>d5ucra1 c.26.1.0 (A:21-278) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
afvptmgnlheghlalvrearkradnvvvsifvnrlqfgqgedfdkyprtlqqdadklaa
egvavvfapdekelypnveqrynvepphlqnelcgkfrpghfrgvatvvsklfnivlpdv
acfgkkdyqqlavikgltedlnfdieivpvdtgraadglalssrnrylsvgeraeaprly
relqavaeslkqggldyaglerqaadhltaagwlvdyveirradtlemaragdkklvvla
aarlgttrlidnvevglp

Sequence, based on observed residues (ATOM records): (download)

>d5ucra1 c.26.1.0 (A:21-278) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
afvptmgnlheghlalvrearkradnvvvsifvnrlqfgqrtlqqdadklaaegvavvfa
pdekelypnveqrynvepphlqnelcgkfrpghfrgvatvvsklfnivlpdvacfgkkdy
qqlavikgltedlnfdieivpvdtgraadglalssrnrylsvgeraeaprlyrelqavae
slkqggldyaglerqaadhltaagwlvdyveirradtlemaragdkklvvlaaarlgttr
lidnvevglp

SCOPe Domain Coordinates for d5ucra1:

Click to download the PDB-style file with coordinates for d5ucra1.
(The format of our PDB-style files is described here.)

Timeline for d5ucra1:

  • d5ucra1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5ucra2