SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h9ba_ (5h9b A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199236Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [238471] (4 PDB entries)
  8. 2284664Domain d5h9ba_: 5h9b A: [327965]
    automated match to d3kk8a_
    complexed with an2, gol, mg

Details for d5h9ba_

PDB Entry: 5h9b (more details), 2.25 Å

PDB Description: drosophila camkii-wt in complex with a fragment of the eag potassium channel and mg2+/amppn
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase II, isoform C

SCOPe Domain Sequences for d5h9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9ba_ d.144.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctrfsdnydikeelgkgafsivkrcvqkstgfefaakiintkkltardfqklerearicr
klhhpnivrlhdsiqeenyhylvfdlvtggelfedivarefyseadashciqqilesvnh
chqngvvhrdlkpenlllaskakgaavkladfglaievqgdhqawfgfagtpgylspevl
kkepygksvdiwacgvilyillvgyppfwdedqhrlysqikagaydypspewdtvtpeak
nlinqmltvnpnkritaaealkhpwicqr

SCOPe Domain Coordinates for d5h9ba_:

Click to download the PDB-style file with coordinates for d5h9ba_.
(The format of our PDB-style files is described here.)

Timeline for d5h9ba_:

  • d5h9ba_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12