Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [238471] (4 PDB entries) |
Domain d5h9ba_: 5h9b A: [327965] automated match to d3kk8a_ complexed with an2, gol, mg |
PDB Entry: 5h9b (more details), 2.25 Å
SCOPe Domain Sequences for d5h9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h9ba_ d.144.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ctrfsdnydikeelgkgafsivkrcvqkstgfefaakiintkkltardfqklerearicr klhhpnivrlhdsiqeenyhylvfdlvtggelfedivarefyseadashciqqilesvnh chqngvvhrdlkpenlllaskakgaavkladfglaievqgdhqawfgfagtpgylspevl kkepygksvdiwacgvilyillvgyppfwdedqhrlysqikagaydypspewdtvtpeak nlinqmltvnpnkritaaealkhpwicqr
Timeline for d5h9ba_: