SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5dpxa_ (5dpx A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205702Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2205821Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2284590Domain d5dpxa_: 5dpx A: [327891]
    automated match to d1smla_
    complexed with l3b, so4, zn

Details for d5dpxa_

PDB Entry: 5dpx (more details), 1.85 Å

PDB Description: 1,2,4-triazole-3-thione compounds as inhibitors of l1, di-zinc metallo-beta-lactamases.
PDB Compounds: (A:) Metallo-beta-lactamase L1 type 3

SCOPe Domain Sequences for d5dpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpxa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d5dpxa_:

Click to download the PDB-style file with coordinates for d5dpxa_.
(The format of our PDB-style files is described here.)

Timeline for d5dpxa_:

  • d5dpxa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12