Lineage for d5dpxb_ (5dpx B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205702Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2205821Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2284605Domain d5dpxb_: 5dpx B: [327906]
    automated match to d1smla_
    complexed with l3b, so4, zn

Details for d5dpxb_

PDB Entry: 5dpx (more details), 1.85 Å

PDB Description: 1,2,4-triazole-3-thione compounds as inhibitors of l1, di-zinc metallo-beta-lactamases.
PDB Compounds: (B:) Metallo-beta-lactamase L1 type 3

SCOPe Domain Sequences for d5dpxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpxb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d5dpxb_:

Click to download the PDB-style file with coordinates for d5dpxb_.
(The format of our PDB-style files is described here.)

Timeline for d5dpxb_:

  • d5dpxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12