Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.2: PDI-like [52849] (2 proteins) |
Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [52854] (1 PDB entry) |
Domain d1hyua3: 1hyu A:1-102 [32779] Other proteins in same PDB: d1hyua1, d1hyua2 |
PDB Entry: 1hyu (more details), 2 Å
SCOP Domain Sequences for d1hyua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium} mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv rkpsflitnpgsqqgprfagsplgheftslvlallwtgghps
Timeline for d1hyua3: