SCOP 1.61: Domain d1hyua4: 1hyu A:103-198

Lineage for d1hyua4 (1hyu A:103-198)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.2: PDI-like [52849] (2 proteins)

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52854] (1 PDB entry)

8. Domain d1hyua4: 1hyu A:103-198 [32780]
   Other proteins in same PDB: d1hyua1, d1hyua2

Details for d1hyua4

PDB Entry: 1hyu, 2 Å

PDB Description: crystal structure of intact ahpf

SCOP Domain Sequences for d1hyua4:

Sequence; same for both SEQRES and ATOM records:

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium}
keaqslleqirdidgdfefetyyslschncpdvvqalnlmavlnprikhtaidggtfqne
iternvmgvpavfvngkefgqgrmtlteivakvdtg

Timeline for d1hyua4:

• d1hyua4 first appeared (with stable ids) in SCOP 1.55
  
• d1hyua4 appears in SCOP 1.59
  
• d1hyua4 appears in SCOP 1.63
  
• d1hyua4 appears in the current release, SCOPe 2.08