Lineage for d1fova_ (1fov A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852426Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 1852438Species Escherichia coli, Grx3 [TaxId:562] [52846] (2 PDB entries)
  8. 1852440Domain d1fova_: 1fov A: [32770]

Details for d1fova_

PDB Entry: 1fov (more details)

PDB Description: glutaredoxin 3 from escherichia coli in the fully oxidized form
PDB Compounds: (A:) glutaredoxin 3

SCOPe Domain Sequences for d1fova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}
anveiytketcpychrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
higgyddlyaldarggldpllk

SCOPe Domain Coordinates for d1fova_:

Click to download the PDB-style file with coordinates for d1fova_.
(The format of our PDB-style files is described here.)

Timeline for d1fova_: