SCOPe 2.01: Domain d1fova_: 1fov A:

Lineage for d1fova_ (1fov A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Escherichia coli, Grx3 [TaxId:562] [52846] (2 PDB entries)

8. Domain d1fova_: 1fov A: [32770]

Details for d1fova_

PDB Entry: 1fov

PDB Description: glutaredoxin 3 from escherichia coli in the fully oxidized form

PDB Compounds: (A:) glutaredoxin 3

SCOPe Domain Sequences for d1fova_:

Sequence; same for both SEQRES and ATOM records:

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}
anveiytketcpychrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
higgyddlyaldarggldpllk

Timeline for d1fova_:

• d1fova_ first appeared (with stable ids) in SCOP 1.55
  
• d1fova_ appears in SCOP 1.75
  
• d1fova_ appears in SCOPe 2.02
  
• d1fova_ appears in the current release, SCOPe 2.08