Lineage for d5mn4a2 (5mn4 A:209-315)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2566676Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2566677Protein automated matches [226843] (8 species)
    not a true protein
  7. 2566700Species Staphylococcus aureus [TaxId:1280] [327472] (9 PDB entries)
  8. 2566705Domain d5mn4a2: 5mn4 A:209-315 [327506]
    Other proteins in same PDB: d5mn4a1
    automated match to d4dxda2
    complexed with gdp, mpd

Details for d5mn4a2

PDB Entry: 5mn4 (more details), 1.5 Å

PDB Description: s. aureus ftsz 12-316 f138a gdp open form (1fof)
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5mn4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mn4a2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d5mn4a2:

Click to download the PDB-style file with coordinates for d5mn4a2.
(The format of our PDB-style files is described here.)

Timeline for d5mn4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mn4a1