Lineage for d5mn4a2 (5mn4 A:209-315)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.0: automated matches [227141] (1 protein)
not a true familyProtein automated matches [226843] (9 species)
not a true proteinSpecies Staphylococcus aureus [TaxId:1280] [327472] (14 PDB entries) 
Domain d5mn4a2: 5mn4 A:209-315 [327506]
Other proteins in same PDB: d5mn4a1
automated match to d4dxda2
complexed with gdp, mpd
Details for d5mn4a2
PDB Entry: 5mn4 (more details), 1.5 Å
PDB Description: s. aureus ftsz 12-316 f138a gdp open form (1fof)
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d5mn4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mn4a2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
SCOPe Domain Coordinates for d5mn4a2:
Click to download the PDB-style file with coordinates for d5mn4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5mn4a2:
- d5mn4a2 first appeared in SCOPe 2.06
- d5mn4a2 appears in SCOPe 2.07
View in 3D
