Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries) |
Domain d5b1sc_: 5b1s C: [327342] automated match to d4yuxb_ complexed with bsx, s4m |
PDB Entry: 5b1s (more details), 1.58 Å
SCOPe Domain Sequences for d5b1sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1sc_ c.66.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 353153]} mpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmald gciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdid gevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklf geafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcg sigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn
Timeline for d5b1sc_: