SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1sc_ (5b1s C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (61 species)
    not a true protein
  7. 2130945Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries)
  8. 2284041Domain d5b1sc_: 5b1s C: [327342]
    automated match to d4yuxb_
    complexed with bsx, s4m

Details for d5b1sc_

PDB Entry: 5b1s (more details), 1.58 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-(2-fluorophenyl)ethanamine
PDB Compounds: (C:) Spermidine synthase, putative

SCOPe Domain Sequences for d5b1sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1sc_ c.66.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmald
gciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdid
gevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklf
geafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcg
sigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d5b1sc_:

Click to download the PDB-style file with coordinates for d5b1sc_.
(The format of our PDB-style files is described here.)

Timeline for d5b1sc_:

  • d5b1sc_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22