Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.1: Thioltransferase [52834] (5 proteins) |
Protein Thioredoxin [52835] (7 species) |
Species Escherichia coli [TaxId:562] [52836] (9 PDB entries) |
Domain d1f6mg_: 1f6m G: [32727] Other proteins in same PDB: d1f6ma1, d1f6ma2, d1f6mb1, d1f6mb2, d1f6me1, d1f6me2, d1f6mf1, d1f6mf2 |
PDB Entry: 1f6m (more details), 2.95 Å
SCOP Domain Sequences for d1f6mg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6mg_ c.47.1.1 (G:) Thioredoxin {Escherichia coli} sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
Timeline for d1f6mg_: