Lineage for d1f6mg_ (1f6m G:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70803Family c.47.1.1: Thioltransferase [52834] (5 proteins)
  6. 70830Protein Thioredoxin [52835] (7 species)
  7. 70838Species Escherichia coli [TaxId:562] [52836] (9 PDB entries)
  8. 70847Domain d1f6mg_: 1f6m G: [32727]
    Other proteins in same PDB: d1f6ma1, d1f6ma2, d1f6mb1, d1f6mb2, d1f6me1, d1f6me2, d1f6mf1, d1f6mf2

Details for d1f6mg_

PDB Entry: 1f6m (more details), 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

SCOP Domain Sequences for d1f6mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6mg_ c.47.1.1 (G:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1f6mg_:

Click to download the PDB-style file with coordinates for d1f6mg_.
(The format of our PDB-style files is described here.)

Timeline for d1f6mg_: