SCOP 1.57: Domain d1f6ma2: 1f6m A:119-244

Lineage for d1f6ma2 (1f6m A:119-244)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)

6. Protein Thioredoxin reductase [51950] (2 species)

7. Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)

8. Domain d1f6ma2: 1f6m A:119-244 [30538]
   Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_

Details for d1f6ma2

PDB Entry: 1f6m, 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

SCOP Domain Sequences for d1f6ma2:

Sequence; same for both SEQRES and ATOM records:

>d1f6ma2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli}
lglpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig

Timeline for d1f6ma2:

• d1f6ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1f6ma2 appears in SCOP 1.59
  
• d1f6ma2 appears in the current release, SCOPe 2.08