SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f3fa_ (5f3f A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2034079Protein automated matches [190569] (10 species)
    not a true protein
  7. 2273653Species Escherichia coli [TaxId:1206108] [316954] (2 PDB entries)
  8. 2283751Domain d5f3fa_: 5f3f A: [327052]
    automated match to d4csta_
    complexed with 5us

Details for d5f3fa_

PDB Entry: 5f3f (more details), 1.76 Å

PDB Description: crystal structure of para-biphenyl-2-methyl-3'-methyl amide mannoside bound to fimh lectin domain
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d5f3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f3fa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 1206108]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5f3fa_:

Click to download the PDB-style file with coordinates for d5f3fa_.
(The format of our PDB-style files is described here.)

Timeline for d5f3fa_:

  • d5f3fa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08