Lineage for d5f3fa_ (5f3f A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2034079Protein automated matches [190569] (10 species)
    not a true protein
  7. 2273653Species Escherichia coli [TaxId:1206108] [316954] (2 PDB entries)
  8. 2283751Domain d5f3fa_: 5f3f A: [327052]
    automated match to d4csta_
    complexed with 5us

Details for d5f3fa_

PDB Entry: 5f3f (more details), 1.76 Å

PDB Description: crystal structure of para-biphenyl-2-methyl-3'-methyl amide mannoside bound to fimh lectin domain
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d5f3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f3fa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 1206108]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5f3fa_:

Click to download the PDB-style file with coordinates for d5f3fa_.
(The format of our PDB-style files is described here.)

Timeline for d5f3fa_:

  • d5f3fa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08