Lineage for d5t6db_ (5t6d B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407327Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)
  8. 2407343Domain d5t6db_: 5t6d B: [326550]
    Other proteins in same PDB: d5t6da2
    automated match to d2fyqa_
    complexed with n38

Details for d5t6db_

PDB Entry: 5t6d (more details), 2.1 Å

PDB Description: 2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5t6db_:

Sequence, based on SEQRES records: (download)

>d5t6db_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records): (download)

>d5t6db_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
lgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

SCOPe Domain Coordinates for d5t6db_:

Click to download the PDB-style file with coordinates for d5t6db_.
(The format of our PDB-style files is described here.)

Timeline for d5t6db_: